PDB entry 2h9d

View 2h9d on RCSB PDB site
Description: Pyruvate-Bound Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aerugionsa
Class: lyase
Keywords: intertwined dimer, LYASE
Deposited on 2006-06-09, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9da1
  • Chain 'B':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9db_
  • Chain 'C':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9dc_
  • Chain 'D':
    Compound: Salicylate biosynthesis protein pchB
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PchB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h9dd_
  • Heterogens: CA, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h9dA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9dA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfervaamlperarwaeengl
    dapfveglfaqiihwyiaeqikyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h9dB (B:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9dB (B:)
    ktpedctgladireaidridldivqalgrrmdyvkaasrfipapervaamlperarwaee
    ngldapfveglfaqiihwyiaeqikyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h9dC (C:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9dC (C:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h9dD (D:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h9dD (D:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrga