Lineage for d2h9dd_ (2h9d D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732500Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2732512Protein Salicylate biosynthesis protein PchB [140938] (1 species)
  7. 2732513Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
    Uniprot Q51507 1-94
  8. 2732517Domain d2h9dd_: 2h9d D: [136253]
    automated match to d2h9ca1
    complexed with ca, pyr

Details for d2h9dd_

PDB Entry: 2h9d (more details), 1.95 Å

PDB Description: pyruvate-bound structure of the isochorismate-pyruvate lyase from pseudomonas aerugionsa
PDB Compounds: (D:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d2h9dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9dd_ a.130.1.1 (D:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqtrga

SCOPe Domain Coordinates for d2h9dd_:

Click to download the PDB-style file with coordinates for d2h9dd_.
(The format of our PDB-style files is described here.)

Timeline for d2h9dd_: