PDB entry 2h5m

View 2h5m on RCSB PDB site
Description: NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus complexed with acetyl-CoA. Northeast Structural Genomics Consortium Target ZR31
Class: transferase
Keywords: GNAT, N-acetyltransferase domain, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, transferase
Deposited on 2006-05-26, released 2006-11-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyltransferase, GNAT family
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: SACOL2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HD32 (0-93)
      • expression tag (94-101)
    Domains in SCOPe 2.04: d2h5ma_
  • Heterogens: ACO

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h5mA (A:)
    msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
    veharennlkiiascsfakhmlekedsyqdvylglehhhhhh