PDB entry 2gzz

View 2gzz on RCSB PDB site
Description: solution structures of the oxidized form of thioredoxin from Bacillus subtilis
Class: electron transport
Keywords: alpha/beta, ELECTRON TRANSPORT
Deposited on 2006-05-12, released 2007-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2gzza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gzzA (A:)
    maivkatdqsfsaetsegvvladfwapwcgpckmiapvleeldqemgdklkivkidvden
    qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl