PDB entry 2gxb

View 2gxb on RCSB PDB site
Description: Crystal Structure of The Za Domain bound to Z-RNA
Class: hydrolase/RNA
Keywords: Z-RNA, Za, ADAR1, RNA editing, PROTEIN-RNA complex, hydrolase/RNA COMPLEX
Deposited on 2006-05-08, released 2007-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.02: d2gxba1
  • Chain 'B':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.02: d2gxbb1
  • Chain 'E':
    Compound: 5'-r(p*(du)p*cp*gp*cp*gp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-r(p*(du)p*cp*gp*cp*gp*cp*g)-3'
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gxbA (A:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gxbA (A:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    ia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gxbB (B:)
    shmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwk
    iavstq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gxbB (B:)
    meqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwkia
    vst
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.