PDB entry 2gpi

View 2gpi on RCSB PDB site
Description: Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 A resolution
Class: unknown function
Keywords: Transcriptional regulation of the shikimate pathway, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-04-17, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Shewanella loihica [TaxId:323850]
    Gene: ZP_00837230.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q33UM0 (1-90)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (29)
    Domains in SCOPe 2.08: d2gpia1, d2gpia2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gpiA (A:)
gmnqsiifteqltwdvqlsaihftaqqqgmvidcyigqkvlehlaaekinnseqalslfe
qfrfdieeqaeklieqeafdvqghiqvervd