SCOPe 2.08: Domain d2gpia1: 2gpi A:1-90

Lineage for d2gpia1 (2gpi A:1-90)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.354: Shew3726-like [160271] (1 superfamily)
   beta(3)-alpha(n)-beta; 2 layers, a/b; mixed beta-sheet, order 1234, strands 3 and 4 are parallel with a left-handed crossover connection

4. Superfamily d.354.1: Shew3726-like [160272] (1 family)
   automatically mapped to Pfam PF07369

5. Family d.354.1.1: Shew3726-like [160273] (1 protein)
   Pfam PF07369; DUF1488

6. Protein Hypothetical protein Shew3726 [160274] (1 species)

7. Species Shewanella loihica [TaxId:359303] [160275] (1 PDB entry)
   Uniprot A3QJE4 1-90

8. Domain d2gpia1: 2gpi A:1-90 [147154]
   Other proteins in same PDB: d2gpia2
   complexed with edo

Details for d2gpia1

PDB Entry: 2gpi, 1.6 Å

PDB Description: Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 A resolution

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2gpia1:

Sequence; same for both SEQRES and ATOM records:

>d2gpia1 d.354.1.1 (A:1-90) Hypothetical protein Shew3726 {Shewanella loihica [TaxId: 359303]}
mnqsiifteqltwdvqlsaihftaqqqgmvidcyigqkvlehlaaekinnseqalslfeq
frfdieeqaeklieqeafdvqghiqvervd

Timeline for d2gpia1:

• d2gpia1 first appeared in SCOP 1.75
  
• d2gpia1 appears in SCOPe 2.07