PDB entry 2gok

View 2gok on RCSB PDB site
Description: Crystal structure of the imidazolonepropionase from Agrobacterium tumefaciens at 1.87 A resolution
Class: hydrolase
Keywords: 9252b, Imidazolonepropionase, Protein Structure Initiative II (PSI-II), Histidine metabolism, Structural Genomics, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2006-04-13, released 2006-04-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazolonepropionase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: hutI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2goka1, d2goka2
  • Chain 'B':
    Compound: Imidazolonepropionase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: hutI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gokb1, d2gokb2
  • Heterogens: FE, MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gokA (A:)
    mslpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdl
    pddlstadettdcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivs
    svrdtralsdevlvaqalprldtllsegvstieiksgygldietelkmlrvarrletlrp
    vrivtsylaahatpadykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeid
    rvfaaaqqrglpvklhaeqlsnlggaelaasynalsadhleyldetgakalakagtvavl
    lpgafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveec
    ltattrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs
    peghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gokA (A:)
    atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
    witpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaq
    alprldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpad
    ykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklh
    aeqlsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppv
    qalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalglla
    etgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gokB (B:)
    mslpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdl
    pddlstadettdcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivs
    svrdtralsdevlvaqalprldtllsegvstieiksgygldietelkmlrvarrletlrp
    vrivtsylaahatpadykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeid
    rvfaaaqqrglpvklhaeqlsnlggaelaasynalsadhleyldetgakalakagtvavl
    lpgafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveec
    ltattrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs
    peghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gokB (B:)
    atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
    witpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaq
    alprldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpad
    ykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklh
    aeqlsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppv
    qalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalglla
    etgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs