Lineage for d2gokb1 (2gok B:17-79,B:381-420)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819370Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)
  6. 2819371Protein Imidazolonepropionase [159348] (2 species)
  7. 2819372Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries)
    Uniprot Q8U8Z6 15-77,379-418
  8. 2819376Domain d2gokb1: 2gok B:17-79,B:381-420 [147147]
    Other proteins in same PDB: d2goka2, d2gokb2
    automated match to d2goka1
    complexed with cl, fe, gol, mg

Details for d2gokb1

PDB Entry: 2gok (more details), 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution
PDB Compounds: (B:) Imidazolonepropionase

SCOPe Domain Sequences for d2gokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gokb1 b.92.1.10 (B:17-79,B:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs

SCOPe Domain Coordinates for d2gokb1:

Click to download the PDB-style file with coordinates for d2gokb1.
(The format of our PDB-style files is described here.)

Timeline for d2gokb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gokb2