PDB entry 2gli

View 2gli on RCSB PDB site
Description: five-finger gli/dna complex
Deposited on 1993-11-09, released 1993-11-09
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gliA (A:)
    etdcrwdgcsqefdsqeqlvhhinsehihgerkefvchwggcsrelrpfkaqymlvvhmr
    rhtgekphkctfegcrksysrlenlkthlrshtgekpymcehegcskafsnasdrakhqn
    rthsnekpyvcklpgctkrytdpsslrkhvktvhg