PDB entry 2gkj

View 2gkj on RCSB PDB site
Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor DL-AZIDAP
Class: Isomerase
Keywords: enzyme-inhibitor complex, covalently bound inhibitor, Isomerase
Deposited on 2006-04-02, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaminopimelate epimerase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gkja1, d2gkja2
  • Heterogens: ZDR, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gkjA (A:)
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
dlpggslmiewngvghplymtgeathiydgfitl