Lineage for d2gkja2 (2gkj A:131-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939537Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2939538Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2939548Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 2939552Domain d2gkja2: 2gkj A:131-274 [135332]
    automated match to d1gqza2
    complexed with acy, zdr

Details for d2gkja2

PDB Entry: 2gkj (more details), 1.7 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor DL-AZIDAP
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2gkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkja2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

SCOPe Domain Coordinates for d2gkja2:

Click to download the PDB-style file with coordinates for d2gkja2.
(The format of our PDB-style files is described here.)

Timeline for d2gkja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gkja1