SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gkja2 (2gkj A:131-274)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164557Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2164558Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2164559Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 2164560Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2164570Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 2164574Domain d2gkja2: 2gkj A:131-274 [135332]
    automated match to d1gqza2
    complexed with acy, zdr

Details for d2gkja2

PDB Entry: 2gkj (more details), 1.7 Å

PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor DL-AZIDAP
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2gkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkja2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

SCOPe Domain Coordinates for d2gkja2:

Click to download the PDB-style file with coordinates for d2gkja2.
(The format of our PDB-style files is described here.)

Timeline for d2gkja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gkja1