PDB entry 2gkd

View 2gkd on RCSB PDB site
Description: Structural insight into self-sacrifice mechanism of enediyne resistance
Class: toxin/DNA
Keywords: START domain protein, TOXIN/DNA COMPLEX
Deposited on 2006-04-01, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalC
    Species: Micromonospora echinospora [TaxId:1877]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gkda_
  • Chain 'B':
    Compound: 5'-d(*gp*cp*ap*tp*ap*tp*gp*ap*tp*ap*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*tp*ap*tp*cp*ap*tp*ap*tp*gp*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gkdA (A:)
nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
mgtkhakrvrngmdkgwptilqsfqdkideegakk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.