PDB entry 2giv

View 2giv on RCSB PDB site
Description: Human MYST histone acetyltransferase 1
Class: transferase
Keywords: histone acetyltransferase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-03-29, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable histone acetyltransferase MYST1
    Species: Homo sapiens [TaxId:9606]
    Gene: MYST1, MOF
    Database cross-references and differences (RAF-indexed):
    • GB NP_115564
      • modified residue (119)
    Domains in SCOPe 2.08: d2giva1
  • Heterogens: ZN, CL, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2givA (A:)
    mgsshhhhhhssglvprgstkvkyvdkihignyeidawyfspfpedygkqpklwlceycl
    kymkyeksyrfhlgqcqwrqppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhk
    tlyfdvepfvfyiltevdrqgahivgyfskekespdgnnvaciltlppyqrrgygkflia
    fsyelsklestvgspekplsdlgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqn
    diistlqslnmvkywkgqhvicvtpklveehlksaqykkppitvdsvclkwappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2givA (A:)
    kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
    gkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
    hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
    gklsyrsywswvllenlrsikdlsqmtsitqndiistlqslnmvkywkgqhvicvtpklv
    eehlppitvdsvclkwap