Lineage for d2giva1 (2giv A:4-274)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533468Protein Probable histone acetyltransferase MYST1 [143672] (1 species)
    ESA1 orthologue
  7. 2533469Species Human (Homo sapiens) [TaxId:9606] [143673] (3 PDB entries)
    Uniprot Q9H7Z6 178-448
  8. 2533470Domain d2giva1: 2giv A:4-274 [135253]
    complexed with aco, cl, zn

Details for d2giva1

PDB Entry: 2giv (more details), 1.94 Å

PDB Description: Human MYST histone acetyltransferase 1
PDB Compounds: (A:) Probable histone acetyltransferase MYST1

SCOPe Domain Sequences for d2giva1:

Sequence, based on SEQRES records: (download)

>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvllenlrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvic
vtpklveehlksaqykkppitvdsvclkwap

Sequence, based on observed residues (ATOM records): (download)

>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvllenlrsikdlsqmtsitqndiistlqslnmvkywkgqhvicvtpklv
eehlppitvdsvclkwap

SCOPe Domain Coordinates for d2giva1:

Click to download the PDB-style file with coordinates for d2giva1.
(The format of our PDB-style files is described here.)

Timeline for d2giva1: