PDB entry 2g8f

View 2g8f on RCSB PDB site
Description: B. halodurans RNase H catalytic domain E188A mutant in complex with Mg2+ and RNA/DNA hybrid (non-P nick at the active site)
Class: hydrolase/RNA/DNA
Keywords: RNAse H, Ribonuclease H RNA/DNA hybrid, HYDROLASE/RNA/DNA COMPLEX
Deposited on 2006-03-02, released 2006-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Bacillus halodurans [TaxId:86665]
    Gene: rnhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9
      • engineered (133)
    Domains in SCOPe 2.02: d2g8fa1
  • Chain 'B':
    Compound: 5'-r(*up*cp*gp*ap*cp*a)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*tp*gp*tp*cp*g)-3'
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g8fA (A:)
    gshmakeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaiv
    hglrylkernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthty
    etpilkwqtdkwgaikadygrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g8fA (A:)
    eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
    kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
    wqtdkwgaikady
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.