PDB entry 2g83

View 2g83 on RCSB PDB site
Description: Structure of activated G-alpha-i1 bound to a nucleotide-state-selective peptide: Minimal determinants for recognizing the active form of a G protein alpha subunit
Class: signaling protein
Keywords: Guanine-nucleotide binding protein, Phage display peptide, SIGNALING PROTEIN
Deposited on 2006-03-01, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.269
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g83a1, d2g83a2
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g83b1, d2g83b2
  • Chain 'C':
    Compound: KB-1753 phage display peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G83 (0-10)
  • Chain 'D':
    Compound: KB-1753 phage display peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G83 (0-10)
  • Heterogens: ALF, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g83A (A:)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsa
    ayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwi
    hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
    lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
    qfvfdavtdviik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g83A (A:)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdsaraddarqlfvlaelagvikrlwkdsgvqacfnrsreyqlndsaayylndldri
    aqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegvtaii
    fcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksp
    lticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdv
    iik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g83B (B:)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlndsa
    ayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwi
    hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
    lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
    qfvfdavtdviik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g83B (B:)
    evkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlk
    idfgdsaraddarqlfvlaelagvikrlwkdsgvqacfnrsreyqlndsaayylndldri
    aqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegvtaii
    fcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksp
    lticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdv
    iik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.