![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries) |
![]() | Domain d2g83b2: 2g83 B:33-60,B:182-345 [134765] Other proteins in same PDB: d2g83a1, d2g83b1 automatically matched to d1kjya2 complexed with alf, gdp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 2g83 (more details), 2.8 Å
SCOPe Domain Sequences for d2g83b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g83b2 c.37.1.8 (B:33-60,B:182-345) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv qfvfdavtdviik
Timeline for d2g83b2: