PDB entry 2g5m

View 2g5m on RCSB PDB site
Description: Spinophilin PDZ domain
Class: protein binding
Keywords: Spinophilin, PDZ domain, CNS, synaptic transmission, PROTEIN BINDING
Deposited on 2006-02-23, released 2007-01-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Neurabin-2
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Ppp1r9b
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35274 (3-112)
    • cloning artifact (0-2)
  Domains in SCOPe 2.04: d2g5mb_

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g5mB (B:)
  ghmelfpvelekdseglgisiigmgagadmgleklgifvktvteggaahrdgriqvndll
  vevdgtslvgvtqsfaasvlrntkgrvrfmigrerpgeqsevaqliqqtleqe