PDB entry 2g1u

View 2g1u on RCSB PDB site
Description: crystal structure of a putative transport protein (tm1088a) from thermotoga maritima at 1.50 a resolution
Class: transport protein
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, transport protein
Deposited on 2006-02-14, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.154
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein tm1088a
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1088a
    Database cross-references and differences (RAF-indexed):
    • PDB 2G1U
    Domains in SCOPe 2.07: d2g1ua_
  • Heterogens: NA, AMP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g1uA (A:)
mgsdkihhhhhhmskkqkskyivifgcgrlgslianlasssghsvvvvdkneyafhrlns
efsgftvvgdaaefetlkecgmekadmvfaftnddstnffismnarymfnvenviarvyd
pekikifeengikticpavlmiekvkefiigseed

    Sequence, based on observed residues (ATOM records): (download) 
    >2g1uA (A:)
kqkskyivifgcgrlgslianlasssghsvvvvdkneyafhrlnsefsgftvvgdaaefe
tlkecgmekadmvfaftnddstnffismnarymfnvenviarvydpekikifeengikti
cpavlmiekvkefiigs