PDB entry 2fyk

View 2fyk on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in complex with ADP and Biotin
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-02-08, released 2006-08-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--protein ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOPe 2.04: d2fyka1, d2fyka2
  • Chain 'B':
    Compound: biotin--protein ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOPe 2.04: d2fykb1, d2fykb2
  • Heterogens: ADP, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fykA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fykB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl