PDB entry 2frw

View 2frw on RCSB PDB site
Description: Solution structure of the second SH3 domain of human adaptor protein NCK2
Class: protein binding
Keywords: sh3, protein binding
Deposited on 2006-01-20, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic protein NCK2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2frwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2frwA (A:)
    ipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd