PDB entry 2fnb

View 2fnb on RCSB PDB site
Description: nmr structure of the fibronectin ed-b domain, nmr, 20 structures
Class: protein binding
Keywords: ed-b, fibronectin, typeiii domain, angiogenesis, protein binding
Deposited on 1998-12-16, released 1998-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (fibronectin)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (0-94)
    • conflict (0-3)
  Domains in SCOPe 2.08: d2fnba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnbA (A:)
  mrgsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvg
  yytvtglepgidydisvitlinggesapttltqqt