![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Fibronectin, different Fn3 modules [49270] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries) |
![]() | Domain d2fnba_: 2fnb A: [21979] ED-B domain |
PDB Entry: 2fnb (more details)
SCOPe Domain Sequences for d2fnba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} mrgsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvg yytvtglepgidydisvitlinggesapttltqqt
Timeline for d2fnba_: