Lineage for d2fnba_ (2fnb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761880Protein Fibronectin, different Fn3 modules [49270] (3 species)
  7. 2761883Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)
  8. 2761893Domain d2fnba_: 2fnb A: [21979]
    ED-B domain

Details for d2fnba_

PDB Entry: 2fnb (more details)

PDB Description: nmr structure of the fibronectin ed-b domain, nmr, 20 structures
PDB Compounds: (A:) protein (fibronectin)

SCOPe Domain Sequences for d2fnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
mrgsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvg
yytvtglepgidydisvitlinggesapttltqqt

SCOPe Domain Coordinates for d2fnba_:

Click to download the PDB-style file with coordinates for d2fnba_.
(The format of our PDB-style files is described here.)

Timeline for d2fnba_: