PDB entry 2fl4

View 2fl4 on RCSB PDB site
Description: The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
Class: transferase
Keywords: Spermine/spermidine acetyltransferase, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2006-01-05, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.213
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermine/spermidine acetyltransferase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: GI:29343124
    Database cross-references and differences (RAF-indexed):
    • GB AAO80887 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2fl4a1, d2fl4a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fl4A (A:)
gmeihfekvtsdnrkavenlqvfaeqqafiesmaenlkesdqfpewesagiydgnqligy
amygrwqdgrvwldrflidqrfqgqgygkaacrllmlkliekyqtnklylsvydtnssai
rlyqqlgfvfngeldtngervmewthqnk

    Sequence, based on observed residues (ATOM records): (download) 
    >2fl4A (A:)
gmeihfekvtsdnrkavenlqvfaeqqafiesmaenlkesdqfpewesagiydgnqligy
amygrwqdgrvwldrflidqrfqgqgygkaacrllmlkliekyqtnklylsvydtnssai
rlyqqlgfvfngeldtngervmewthq