PDB entry 2fl1

View 2fl1 on RCSB PDB site
Description: Crystal structure of red fluorescent protein from Zoanthus, zRFP574, at 2.4A resolution
Class: fluorescent protein
Keywords: Red fluorescent protein, button polyp, Zoanthus sp., crystal structure, chromophore, beta-can fold, beta barrel, tightly packed tetramer, intersubunit interface, fluorescent marker, emission maximum 574nm, zRFP574
Deposited on 2006-01-05, released 2007-01-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (0-227)
      • engineered (1)
      • see remark 999 (62)
  • Chain 'B':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (0-227)
      • engineered (1)
      • see remark 999 (62)
  • Chain 'C':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (0-227)
      • engineered (1)
      • see remark 999 (62)
  • Chain 'D':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (0-227)
      • engineered (1)
      • see remark 999 (62)
    Domains in SCOPe 2.02: d2fl1d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl1D (D:)
    sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa
    afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe
    stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt
    iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp