PDB entry 2fj9

View 2fj9 on RCSB PDB site
Description: High resolution crystal structure of the unliganded human ACBP
Class: lipid binding protein
Keywords: fatty acid metabolism, acbp, lipid binding protein
Deposited on 2006-01-02, released 2006-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-coa-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DBI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fj9a_
  • Heterogens: PB, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fj9A (A:)
    sqaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawne
    lkgtskedamkayinkveelkkkygi