PDB entry 2fhj

View 2fhj on RCSB PDB site
Description: Crystal structure of formylmethanofuran: tetrahydromethanopterin formyltransferase in complex with its coenzymes
Class: transferase
Keywords: tetrahydromethanopterin; methanofuran; C1 metabolism; formyltransferase; complex
Deposited on 2005-12-25, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: FTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fhja1, d2fhja2
  • Chain 'B':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: FTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fhjb1, d2fhjb2
  • Chain 'C':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: FTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fhjc1, d2fhjc2
  • Chain 'D':
    Compound: Formylmethanofuran--tetrahydromethanopterin formyltransferase
    Species: Methanopyrus kandleri [TaxId:2320]
    Gene: FTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q49610 (0-295)
      • modified residue (57)
    Domains in SCOPe 2.07: d2fhjd1, d2fhjd2
  • Heterogens: K, MFN, H4Z, PE4, PE3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fhjA (A:)
    meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
    vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
    gyklsffgdgyqeedeldgrkvwkipvvegefivedsfgittgvaggnfyimaesqpagl
    qaaeaavdaikgvegayapfpggivasaskvgskqydflpastndaycptvednelpegv
    kcvyeivinglneeavkeamrvgieaacqqpgvvkisagnfggklgqyeihlhdlf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fhjB (B:)
    meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
    vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
    gyklsffgdgyqeedeldgrkvwkipvvegefivedsfgittgvaggnfyimaesqpagl
    qaaeaavdaikgvegayapfpggivasaskvgskqydflpastndaycptvednelpegv
    kcvyeivinglneeavkeamrvgieaacqqpgvvkisagnfggklgqyeihlhdlf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fhjC (C:)
    meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
    vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
    gyklsffgdgyqeedeldgrkvwkipvvegefivedsfgittgvaggnfyimaesqpagl
    qaaeaavdaikgvegayapfpggivasaskvgskqydflpastndaycptvednelpegv
    kcvyeivinglneeavkeamrvgieaacqqpgvvkisagnfggklgqyeihlhdlf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fhjD (D:)
    meingveiedtfaeafeakmarvlitaashkwamiavkeatgfgtsvimcpaeagidcgy
    vppeetpdgrpgvtimighndedelkeqlldrigqcvmtaptasafdampeaekededrv
    gyklsffgdgyqeedeldgrkvwkipvvegefivedsfgittgvaggnfyimaesqpagl
    qaaeaavdaikgvegayapfpggivasaskvgskqydflpastndaycptvednelpegv
    kcvyeivinglneeavkeamrvgieaacqqpgvvkisagnfggklgqyeihlhdlf