Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families) duplication: contains two subdomains of this fold |
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
Species Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries) |
Domain d2fhjd2: 2fhj D:149-296 [133486] automated match to d1ftra2 complexed with h4z, k, mfn, pe3, pe4 |
PDB Entry: 2fhj (more details), 2 Å
SCOPe Domain Sequences for d2fhjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhjd2 d.58.33.1 (D:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Methanopyrus kandleri [TaxId: 2320]} egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac qqpgvvkisagnfggklgqyeihlhdlf
Timeline for d2fhjd2: