PDB entry 2fce

View 2fce on RCSB PDB site
Description: Solution structure of C-lobe Myosin Light Chain from Saccharomices cerevisiae
Class: Cell Cycle
Keywords: EF-HAND PROTEIN, Cell Cycle
Deposited on 2005-12-12, released 2006-11-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin light chain 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MLC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2fcea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fceA (A:)
kaktedfvkafqvfdkestgkvsvgdlrymltglgekltdaevdellkgvevdsngeidy
kkfiedvlrq