PDB entry 2f7d

View 2f7d on RCSB PDB site
Description: A mutant rabbit cathepsin K with a nitrile inhibitor
Class: hydrolase
Keywords: papain cysteine protease, HYDROLASE
Deposited on 2005-11-30, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: CTSK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43236 (0-214)
      • engineered (60)
      • engineered (159)
    Domains in SCOPe 2.07: d2f7da1
  • Heterogens: NOQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f7dA (A:)
tpdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydencssdnlnhavlavgygiqkgnkhwii
knswgeswgnkgyilmarnknnacgianlasfpkm