PDB entry 2f5d

View 2f5d on RCSB PDB site
Description: Bacillus subtilis manganese transport regulator (MNTR) bound to manganese, AC conformation, pH 6.5
Class: transcription
Keywords: helix-turn-helix, DNA-binding protein, metalloregulatory protein, transcription
Deposited on 2005-11-25, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: mntR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOPe 2.07: d2f5da1, d2f5da2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: mntR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • see remark 999 (80)
    Domains in SCOPe 2.07: d2f5db1, d2f5db2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f5dA (A:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5dA (A:)
    tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvltskg
    kkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddar
    kkdlksiqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f5dB (B:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5dB (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvltsk
    gkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeedda
    rkkdlksiqkk