SCOPe 2.08: Domain d2f5da2: 2f5d A:63-136

Lineage for d2f5da2 (2f5d A:63-136)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)

8. Domain d2f5da2: 2f5d A:63-136 [132980]
   Other proteins in same PDB: d2f5da1, d2f5db1
   automated match to d1on1a2
   complexed with mn

Details for d2f5da2

PDB Entry: 2f5d, 1.9 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to manganese, AC conformation, pH 6.5

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2f5da2:

Sequence; same for both SEQRES and ATOM records:

>d2f5da2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d2f5da2:

• d2f5da2 first appeared in SCOP 1.73
  
• d2f5da2 appears in SCOPe 2.07