PDB entry 2f42

View 2f42 on RCSB PDB site
Description: dimerization and U-box domains of Zebrafish C-terminal of HSP70 interacting protein
Class: chaperone
Keywords: U-box, CHAPERONE
Deposited on 2005-11-22, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.266
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: STIP1 homology and U-Box containing protein 1
    Species: Danio rerio [TaxId:7955]
    Gene: stub1 (amino acids 112-284)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f42a1, d2f42a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f42A (A:)
gidpftqrlnfgddipsalriakkkrwnsieekrisqenelhaylsklilaekerelddr
vkqsddsqnggdiskmkskhdkylmdmdelfsqvdekrkkreipdylcgkisfelmrepc
itpsgitydrkdieehlqrvghfdpvtrspltqdqlipnlamkevidafiqengwvedy

    Sequence, based on observed residues (ATOM records): (download) 
    >2f42A (A:)
akkkrwnsieekrisqenelhaylsklilaekerelddskhdkylmdmdelfsqvdekrk
kreipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipn
lamkevidafiqengwve