PDB entry 2f0w

View 2f0w on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease mutant V23I/L25I/V66L/I72L
Class: hydrolase
Keywords: DNA hydrolase; RNA hydrolase; endonuclease; calcium; signal, hydrolase
Deposited on 2005-11-13, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (22)
      • engineered (24)
      • engineered (65)
      • engineered (71)
      • variant (123)
    Domains in SCOPe 2.07: d2f0wa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f0wA (A:)
atstkklhkepatlikaidgdtikimykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmlenakklevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >2f0wA (A:)
klhkepatlikaidgdtikimykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
lenakklevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws