PDB entry 2ezi

View 2ezi on RCSB PDB site
Description: solution nmr structure of the igamma subdomain of the mu end DNA binding domain of mu phage transposase, 30 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, transposition
Deposited on 1997-07-25, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transposase
  Species: Enterobacteria phage Mu [TaxId:10677]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07636 (1-74)
  Domains in SCOPe 2.07: d2ezia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eziA (A:)
  mnvhksefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqld
  eamvvacregehalm