PDB entry 2ezi

View 2ezi on RCSB PDB site
Description: solution nmr structure of the igamma subdomain of the mu end DNA binding domain of mu phage transposase, 30 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, transposition
Deposited on 1997-07-25, released 1997-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transposase
    Species: Enterobacteria phage Mu [TaxId:10677]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ezia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eziA (A:)
    mnvhksefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqld
    eamvvacregehalm