Lineage for d2ezia_ (2ezi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692028Protein Transposase [46737] (1 species)
  7. 2692029Species Bacteriophage Mu [TaxId:10677] [46738] (2 PDB entries)
  8. 2692030Domain d2ezia_: 2ezi A: [16028]

Details for d2ezia_

PDB Entry: 2ezi (more details)

PDB Description: solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, 30 structures
PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2ezia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezia_ a.4.1.2 (A:) Transposase {Bacteriophage Mu [TaxId: 10677]}
mnvhksefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqld
eamvvacregehalm

SCOPe Domain Coordinates for d2ezia_:

Click to download the PDB-style file with coordinates for d2ezia_.
(The format of our PDB-style files is described here.)

Timeline for d2ezia_: