Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
Protein Transposase [46737] (1 species) |
Species Bacteriophage Mu [TaxId:10677] [46738] (2 PDB entries) |
Domain d2ezia_: 2ezi A: [16028] |
PDB Entry: 2ezi (more details)
SCOPe Domain Sequences for d2ezia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezia_ a.4.1.2 (A:) Transposase {Bacteriophage Mu [TaxId: 10677]} mnvhksefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqld eamvvacregehalm
Timeline for d2ezia_: