PDB entry 2et7

View 2et7 on RCSB PDB site
Description: Structural and spectroscopic insights into the mechanism of oxalate oxidase
Class: oxidoreductase
Keywords: Double stranded beta-helix, cupin, OXIDOREDUCTASE
Deposited on 2005-10-27, released 2005-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxalate oxidase 1
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45850 (0-200)
      • engineered (74)
    Domains in SCOPe 2.06: d2et7a1
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2et7A (A:)
    sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
    vaewpgtntlgvsmarvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
    rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
    kalrveagvvellkskfaggs