PDB entry 2eq0

View 2eq0 on RCSB PDB site
Description: Solution structure of the 8th C2H2 type zinc finger domain of Zinc finger protein 347
Class: structural genomics, unknown function
Keywords: C2H2, zinc finger domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 347
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF347, ZNF1111
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96SE7 (7-39)
      • expression tag (0-6)
      • expression tag (40-45)
    Domains in SCOPe 2.07: d2eq0a1, d2eq0a2, d2eq0a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eq0A (A:)
    gssgssgtgekpykchecgkvfrrnshlarhqlihtgekpsgpssg