PDB entry 2enr

View 2enr on RCSB PDB site
Description: co-crystals of demetallized concanavalin a with cadmium having a cadmium ion bound in both the s1 site and the s2 site
Class: lectin
Keywords: concanavalin a, plant lectin, carbohydrate binding, metal binding, cadmium
Deposited on 1998-07-14, released 1999-02-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.173
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (95-236)
      • conflict (96-97)
      • conflict (99-101)
      • insertion (103)
      • conflict (104)
      • conflict (106-115)
      • conflict (117)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.04: d2enra_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2enrA (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan