PDB entry 2eli

View 2eli on RCSB PDB site
Description: Solution structure of the second Phorbol esters/diacylglycerol binding domain of human Protein kinase C alpha type
Class: transferase
Keywords: PKC-alpha, PKC-A, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-03-27, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C alpha type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17252 (8-84)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2elia1, d2elia2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eliA (A:)
gssgssggpdtddprskhkfkihtygsptfcdhcgsllyglihqgmkcdtcdmnvhkqcv
invpslcgmdhtekrgriylkaeva