Lineage for d2elia1 (2eli A:9-85)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 3037826Protein automated matches [193184] (2 species)
    not a true protein
  7. 3037827Species Human (Homo sapiens) [TaxId:9606] [255148] (1 PDB entry)
  8. 3037828Domain d2elia1: 2eli A:9-85 [241774]
    Other proteins in same PDB: d2elia2
    automated match to d1tbna_
    complexed with zn

Details for d2elia1

PDB Entry: 2eli (more details)

PDB Description: solution structure of the second phorbol esters/diacylglycerol binding domain of human protein kinase c alpha type
PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d2elia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2elia1 g.49.1.1 (A:9-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdtddprskhkfkihtygsptfcdhcgsllyglihqgmkcdtcdmnvhkqcvinvpslcg
mdhtekrgriylkaeva

SCOPe Domain Coordinates for d2elia1:

Click to download the PDB-style file with coordinates for d2elia1.
(The format of our PDB-style files is described here.)

Timeline for d2elia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2elia2