![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
![]() | Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
![]() | Protein automated matches [193184] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255148] (1 PDB entry) |
![]() | Domain d2elia1: 2eli A:9-85 [241774] Other proteins in same PDB: d2elia2 automated match to d1tbna_ complexed with zn |
PDB Entry: 2eli (more details)
SCOPe Domain Sequences for d2elia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2elia1 g.49.1.1 (A:9-85) automated matches {Human (Homo sapiens) [TaxId: 9606]} pdtddprskhkfkihtygsptfcdhcgsllyglihqgmkcdtcdmnvhkqcvinvpslcg mdhtekrgriylkaeva
Timeline for d2elia1: