PDB entry 2eht

View 2eht on RCSB PDB site
Description: Crystal structure of acyl carrier protein from Aquifex aeolicus (form 2)
Class: lipid transport
Keywords: LIPID TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-08, released 2007-09-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.196
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ehta_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ehtA (A:)
    sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek
    iqtvgdvinylkekvgg