PDB entry 2egn

View 2egn on RCSB PDB site
Description: Crystal Structure of Tamalin PDZ Domain in Complex with mGluR5 C-terminal Peptide
Class: protein binding
Keywords: PDZ domain, peptide complex, PROTEIN BINDING
Deposited on 2007-03-01, released 2007-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.259
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General receptor for phosphoinositides 1-associated scaffold protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R4T5 (2-95)
      • engineered (41)
    Domains in SCOPe 2.04: d2egna_
  • Chain 'B':
    Compound: mGluR5 C-terminal peptide
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2EGN (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2egnA (A:)
gsqqrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdt
iasvnglnvegirhreivdiikasgnvlrletlygt

    Sequence, based on observed residues (ATOM records): (download) 
    >2egnA (A:)
qqrkvltlekgdnqtfgfeiqtygvtfvarvhesspaqlagltpgdtiasvnglnvegir
hreivdiikasgnvlrletlygt

  • Chain 'B':
    No sequence available.