PDB entry 2eej

View 2eej on RCSB PDB site
Description: Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1
Class: metal binding protein
Keywords: PDZ domain, regulatory factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-02-15, released 2008-02-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pdz domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdzk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T2W1 (7-89)
      • expression tag (0-6)
      • expression tag (90-95)
    Domains in SCOPe 2.04: d2eeja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eejA (A:)
gssgssgpklcrlakgengygfhlnairglpgsfikevqkggpadlaglededviievng
vnvldepyekvvdriqssgknvtllvcgkksgpssg