PDB entry 2edz

View 2edz on RCSB PDB site
Description: Solution structures of the PDZ domain of mus musculus PDZ domain-containing protein 1
Class: signaling protein
Keywords: CFTR-associated protein of 70 kDa, Na/Pi cotransporter C-terminal-associated protein, NaPi-Cap1, Na(+)/H(+) exchanger regulatory factor 3, Sodium-hydrogen exchanger regulatory factor 3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-02-15, released 2008-01-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pdz domain-containing protein 1
  Species: Mus musculus [TaxId:10090]
  Gene: Pdzk1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JIL4 (7-113)
    • expression tag (0-6)
  Domains in SCOPe 2.04: d2edza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2edzA (A:)
  gssgssgmastfnprecklskqegqnygfflriekdtdghlirvieegspaekaglldgd
  rvlringvfvdkeehaqvvelvrksgnsvtllvldgdsyekavknqvdlkeldq