PDB entry 2edv

View 2edv on RCSB PDB site
Description: Solution structure of the PDZ domain from human FERM and PDZ domain containing 1
Class: protein binding
Keywords: cytoskeletal-associated protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FERM and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FRMPD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14C73 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.04: d2edva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2edvA (A:)
    gssgssgvrhtvkidkdtllqdygfhiseslpltvvavtaggsahgklfpgdqilqmnne
    paedlsweravdilreaedslsitvvrctssgpssg