PDB entry 2edu

View 2edu on RCSB PDB site
Description: Solution structure of RSGI RUH-070, a C-terminal domain of kinesin-like protein KIF22 from human cDNA
Class: transport protein
Keywords: kinesin, kinesin-like 4, kinesin-like DNA binding domain, helix turn helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2007-02-15, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Kinesin-like protein KIF22
  Species: Homo sapiens [TaxId:9606]
  Gene: KIF22
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14807 (7-97)
    • cloning artifact (0-6)
  Domains in SCOPe 2.08: d2edua1, d2edua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eduA (A:)
  gssgssgekaedcwelqispellahgrqkildllnegsardlrslqrigpkkaqlivgwr
  elhgpfsqvedlervegitgkqmesflkanilglaagq