PDB entry 2ecl

View 2ecl on RCSB PDB site
Description: Solution Structure of the RING domain of the human RING-box protein 2
Class: metal binding protein
Keywords: RING-box protein 2, RNF7, RING domian, zinc-binding domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-02-13, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RING-box protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBF6 (7-80)
    • cloning artifact (0-6)
  Domains in SCOPe 2.07: d2ecla1, d2ecla2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eclA (A:)
  gssgssgmwswdvecdtcaicrvqvmdaclrcqaenkqedcvvvwgecnhsfhnccmslw
  vkqnnrcplcqqdwvvqrigk